TXNDC15 antibody (C-Term)

Catalog No. ABIN636013

This Rabbit Polyclonal antibody specifically detects TXNDC15 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TXNDC15 antibody (C-Term) (ABIN636013)

Target: TXNDC15 (Thioredoxin Domain Containing 15 (TXNDC15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TXNDC15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TXNDC15 Antibody

Binding Specificity: C-Term

Specificity: TXNDC15 antibody was raised against the C terminal of TXNDC15

Purification: Affinity purified

Immunogen: TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TXNDC15 Blocking Peptide, (ABIN5616851), is also available for use as a blocking control in assays to test for specificity of this TXNDC15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TXNDC15

Target: TXNDC15 (Thioredoxin Domain Containing 15 (TXNDC15))

Alternative Name: TXNDC15

Background: TXNDC15 is a single-pass type I membrane protein. It contains 1 thioredoxin domain.

Molecular Weight: 40 kDa (MW of target protein)